![]() |
Plant Transcription
Factor Database
v4.0
Previous version:
v3.0
|
Home BLAST Prediction RegMap ATRM Download Help About Links |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Zpz_sc00991.1.g00060.1.sm.mk | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
|
||||||||
Family | M-type_MADS | ||||||||
Protein Properties | Length: 155aa MW: 17378.7 Da PI: 9.4755 | ||||||||
Description | M-type_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 91.8 | 3.3e-29 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien++ rqvtfskRr g++KKA+ELS+LCdaev +++fsstg+lye++s Zpz_sc00991.1.g00060.1.sm.mk 9 KRIENSTSRQVTFSKRRGGLFKKAKELSILCDAEVGLVVFSSTGHLYEFAS 59 79***********************************************86 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 31.861 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 2.9E-40 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 5.39E-45 | 2 | 77 | No hit | No description |
SuperFamily | SSF55455 | 7.46E-33 | 2 | 77 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 8.5E-29 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 6.2E-27 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 8.5E-29 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 8.5E-29 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 155 aa Download sequence Send to blast |
MGRGKIVIKR IENSTSRQVT FSKRRGGLFK KAKELSILCD AEVGLVVFSS TGHLYEFAST 60 SMKSVIERYN EANEDHHMAI NARAEAKKKS KDQVMIDQIQ ELNRKVYGQS VSENPTGTTV 120 SNSILNTEDE NIHINLELRQ PLNVEKEKSG TPSLI |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3kov_A | 6e-24 | 2 | 82 | 1 | 81 | Myocyte-specific enhancer factor 2A |
3kov_B | 6e-24 | 2 | 82 | 1 | 81 | Myocyte-specific enhancer factor 2A |
3kov_I | 6e-24 | 2 | 82 | 1 | 81 | Myocyte-specific enhancer factor 2A |
3kov_J | 6e-24 | 2 | 82 | 1 | 81 | Myocyte-specific enhancer factor 2A |
3p57_A | 6e-24 | 2 | 82 | 1 | 81 | Myocyte-specific enhancer factor 2A |
3p57_B | 6e-24 | 2 | 82 | 1 | 81 | Myocyte-specific enhancer factor 2A |
3p57_C | 6e-24 | 2 | 82 | 1 | 81 | Myocyte-specific enhancer factor 2A |
3p57_D | 6e-24 | 2 | 82 | 1 | 81 | Myocyte-specific enhancer factor 2A |
3p57_I | 6e-24 | 2 | 82 | 1 | 81 | Myocyte-specific enhancer factor 2A |
3p57_J | 6e-24 | 2 | 82 | 1 | 81 | Myocyte-specific enhancer factor 2A |
Search in ModeBase |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004973502.1 | 2e-62 | PREDICTED: MADS-box transcription factor 23-like | ||||
Swissprot | Q6VAM4 | 2e-48 | MAD23_ORYSJ; MADS-box transcription factor 23 | ||||
TrEMBL | A0A0E0IC72 | 8e-58 | A0A0E0IC72_ORYNI; Uncharacterized protein | ||||
STRING | OB08G23110.1 | 3e-49 | (Oryza brachyantha) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP129 | 38 | 398 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G37940.1 | 3e-42 | AGAMOUS-like 21 |