PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00991.1.g00060.1.sm.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family M-type_MADS
Protein Properties Length: 155aa    MW: 17378.7 Da    PI: 9.4755
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00991.1.g00060.1.sm.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF91.83.3e-29959151
                                  S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                        SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                                  krien++ rqvtfskRr g++KKA+ELS+LCdaev +++fsstg+lye++s
  Zpz_sc00991.1.g00060.1.sm.mk  9 KRIENSTSRQVTFSKRRGGLFKKAKELSILCDAEVGLVVFSSTGHLYEFAS 59
                                  79***********************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006631.861161IPR002100Transcription factor, MADS-box
SMARTSM004322.9E-40160IPR002100Transcription factor, MADS-box
CDDcd002655.39E-45277No hitNo description
SuperFamilySSF554557.46E-33277IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004048.5E-29323IPR002100Transcription factor, MADS-box
PfamPF003196.2E-271057IPR002100Transcription factor, MADS-box
PRINTSPR004048.5E-292338IPR002100Transcription factor, MADS-box
PRINTSPR004048.5E-293859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 155 aa     Download sequence    Send to blast
MGRGKIVIKR IENSTSRQVT FSKRRGGLFK KAKELSILCD AEVGLVVFSS TGHLYEFAST  60
SMKSVIERYN EANEDHHMAI NARAEAKKKS KDQVMIDQIQ ELNRKVYGQS VSENPTGTTV  120
SNSILNTEDE NIHINLELRQ PLNVEKEKSG TPSLI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3kov_A6e-24282181Myocyte-specific enhancer factor 2A
3kov_B6e-24282181Myocyte-specific enhancer factor 2A
3kov_I6e-24282181Myocyte-specific enhancer factor 2A
3kov_J6e-24282181Myocyte-specific enhancer factor 2A
3p57_A6e-24282181Myocyte-specific enhancer factor 2A
3p57_B6e-24282181Myocyte-specific enhancer factor 2A
3p57_C6e-24282181Myocyte-specific enhancer factor 2A
3p57_D6e-24282181Myocyte-specific enhancer factor 2A
3p57_I6e-24282181Myocyte-specific enhancer factor 2A
3p57_J6e-24282181Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004973502.12e-62PREDICTED: MADS-box transcription factor 23-like
SwissprotQ6VAM42e-48MAD23_ORYSJ; MADS-box transcription factor 23
TrEMBLA0A0E0IC728e-58A0A0E0IC72_ORYNI; Uncharacterized protein
STRINGOB08G23110.13e-49(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP12938398
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37940.13e-42AGAMOUS-like 21